PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01346.50
Common NameJCGZ_11093, LOC105637188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YC
Protein Properties Length: 274aa    MW: 30364.7 Da    PI: 4.5969
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01346.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.57.4e-196861898
          NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                   ++++P arikki+++dedv +i+  +P l+ska elf+ +l  r++  + +   +tl+   ++++v+  ++fdfl +iv r
  Jcr4S01346.50  6 DTRFPAARIKKIMQTDEDVGKIAMAVPLLVSKALELFLQDLCDRTYAITLKRGAKTLNSLHLKQCVQTFNVFDFLREIVSR 86
                   5789*************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.1E-26372IPR009072Histone-fold
SuperFamilySSF471132.92E-19488IPR009072Histone-fold
PfamPF008089.6E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQT DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YAITLKRGAK  60
TLNSLHLKQC VQTFNVFDFL REIVSRVPDL GGSDTTGDDR VVAKRRKVAD DEDTDSEEEL  120
NQSIMHEAVH TSGSGRGRGR GRGRGRGRGS RAAQSGKFED EPDISHDEKP SPTIESLDDV  180
DELEDMKENI QGSRSPQAPV HDFDLNVGLD ENGESKTVLT ATPTNSTAKP TPKMKNELSG  240
WSLADIETMD VDPIHLANLN GRIDEDEEDY DEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137147RGRGRGRGRGR
2139148RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075998.10.0PREDICTED: dr1-associated corepressor-like
TrEMBLA0A067KHP60.0A0A067KHP6_JATCU; Uncharacterized protein
STRINGGLYMA02G44500.21e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.18e-66nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]